PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01029.1_g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 65aa    MW: 7487.4 Da    PI: 9.1113
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01029.1_g00022.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.61.5e-0926622157
                             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1 21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                             R+RKka++ eLe++vk Le+ N++L ++l++ ++e  
  Rsa1.0_01029.1_g00022.1 26 RERKKAYLGELENRVKDLENRNSELEEKLSTFQNENL 62
                             9*****************************9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579592.81E-82464No hitNo description
PfamPF001701.9E-72561IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-112661No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MATAGNKNIN AKLVAEEQSF STASKRERKK AYLGELENRV KDLENRNSEL EEKLSTFQNE  60
NLMLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1766791e-54AY176679.1 Brassica rapa subsp. pekinensis HY5 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121971.11e-17PREDICTED: transcription factor HY5
RefseqXP_013668083.11e-17PREDICTED: transcription factor HY5
RefseqXP_013687403.11e-17PREDICTED: transcription factor HY5-like
RefseqXP_013609113.11e-17PREDICTED: transcription factor HY5
SwissprotO246461e-17HY5_ARATH; Transcription factor HY5
TrEMBLA0A078BYF71e-17A0A078BYF7_BRANA; BnaA10g21200D protein
TrEMBLA0A078E7S71e-17A0A078E7S7_BRANA; BnaC09g45380D protein
TrEMBLA0A0D3EG971e-17A0A0D3EG97_BRAOL; Uncharacterized protein
TrEMBLM4CXM91e-17M4CXM9_BRARP; Uncharacterized protein
STRINGBra008976.1-P4e-17(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56912749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.18e-19bZIP family protein